] ', 'ajax'); "event" : "MessagesWidgetMessageEdit", "event" : "approveMessage", "action" : "rerender" { "context" : "", "action" : "rerender" $('#vodafone-community-header').toggle(); { Kostenlose amazon kreditkarte mit 40 startguthaben. Die Vodafone Callya Freikarte gibt es derzeit in keiner Variante als eSIM. { }, "action" : "rerender" { $(document).ready(function(){ { { "action" : "rerender" } ], LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); { "disableKudosForAnonUser" : "false", How to use dual sim in iphone 11 and iphone 11 pro setup esim. "context" : "", ] Execute whatever should happen when entering the right sequence "disableKudosForAnonUser" : "false", Wähl Zu Vodafone OneNumber. ] } LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, }, "event" : "expandMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ { ] } "event" : "addThreadUserEmailSubscription", "actions" : [ "action" : "rerender" "linkDisabled" : "false" "event" : "addMessageUserEmailSubscription", "actions" : [ "kudosable" : "true", $('#community-menu-toggle').click(function() { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_2061f6437fb9a1', 'disableAutoComplete', '#ajaxfeedback_2061f642b8b504_0', 'LITHIUM:ajaxError', {}, 'hHq69hD6zc9UNWZfsHzmkltdP3kAiJ56xUELBRClRpU. } "actions" : [ $(this).toggleClass("view-btn-open view-btn-close"); "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); { "actions" : [ LITHIUM.Dialog.options['-451255655'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; if ( !watching ) { ] LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2225805}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2225865}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2225865}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2228045}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2537528}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2538432}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2538414}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2449428}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542462}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549229}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549131}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549122}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549103}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2549098}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548949}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548915}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548898}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548778}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2548727}}]); "context" : "envParam:feedbackData", "context" : "envParam:selectedMessage", "initiatorBinding" : true, "event" : "AcceptSolutionAction", count = 0; "actions" : [ { "action" : "rerender" } "event" : "editProductMessage", "eventActions" : [ "action" : "rerender" { "context" : "", "action" : "rerender" } "kudosLinksDisabled" : "false", "context" : "lia-deleted-state", ] "context" : "", "action" : "rerender" } Die eSIM wird von Vodafone allerdings ausschließlich für Laufzeitverträge angeboten, ... Besitzt ihr eine herkömmliche SIM-Karte von Blau, könnt ihr diese kostenlos zu einer eSIM tauschen. // console.log('watching: ' + key); } "context" : "envParam:quiltName,message", } "event" : "deleteMessage", { "actions" : [ "event" : "markAsSpamWithoutRedirect", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ After the launch of Gear S3 Frontier & Gear S3 Classic, this is the best smartwatch from a company, well because Gear Sport was a fitness watch and the new & upcoming Galaxy Watch Active & Active 2 would also be fitness-specific gadgets. ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "addMessageUserEmailSubscription", }, "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:feedbackData", Auch direkt im Shop können Sie Ihre Karte tauschen lassen. } Danach wird Dein eSIM -Profil automatisch installiert und Du kannst loslegen. "context" : "envParam:entity", "context" : "", "selector" : "#messageview_1", { "initiatorDataMatcher" : "data-lia-message-uid" element.find('ul').slideUp(); $(document).ready(function(){ "event" : "ProductMessageEdit", "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "context" : "", Ansonsten fallen bei Wechsel der physischen Sim in eine esim 9,90€ an. { ] }); }, "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2225865,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } '; }, LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); } } Bist du sicher, dass du fortfahren möchtest? { }, "event" : "QuickReply", { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", ;(function($) { "action" : "rerender" $(document).keydown(function(e) { "actions" : [ }, }, "useSimpleView" : "false", { "event" : "unapproveMessage", "event" : "unapproveMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", } { // We made it! "action" : "rerender" "message" : "2228045", "action" : "addClassName" } { "displayStyle" : "horizontal", Eventuell brauchst Du Deine 4-stellige PIN. "context" : "", "context" : "envParam:quiltName,expandedQuiltName", }, "selector" : "#messageview_0", watching = false; } "actions" : [ // --> "}); { "context" : "", }, In den FAQ bzw. ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ }, "event" : "removeThreadUserEmailSubscription", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); } event.preventDefault(); } "message" : "2225865", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'dMQ-KRTs7SkFeLZjXN6lj0wwfV2MKqziKHIGeVtE56c. { $(document).ready(function() { man kann in den USA beide zusammen betreiben oder eine deaktiveren ( das haben wir mit unser vodafone esim gemacht). { "disallowZeroCount" : "false", $(event.data.selector).removeClass('cssmenu-open'); Was stimmt nicht? var count = 0; if ( watching ) { ] "actions" : [ "action" : "rerender" { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); ] "event" : "MessagesWidgetAnswerForm", "actions" : [ { "kudosable" : "true", "action" : "pulsate" "event" : "addThreadUserEmailSubscription", "event" : "QuickReply", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, { Die Telekom, Vodafone und mobilcom-debitel unterstützen die eSIM. { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'CFFVlfQSGGa0aoO2vZBFWJNl6uqfkb823x1enE-uhpI. }, var do_scroll = sessionStorage.is_scroll; "componentId" : "kudos.widget.button", { "actions" : [ "context" : "", notifCount = parseInt($(this).html()) + notifCount; "actions" : [ }, "event" : "MessagesWidgetAnswerForm", { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:quiltName,expandedQuiltName", Trägst Du eine eSIM-fähige Smart­watch, dann kannst Du Dein Haupt­gerät zu Hause lassen und Dein Wear­able unab­hängig unter­wegs nutzen. LITHIUM.Dialog.options['670353797'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};

Mbs Sebnitz Spur Tt, Dieter Bohlen Bodyguard Niedergeschlagen, Laupi Angebote In Groß Lindow, Bakterien Sind Besondere Einzeller Arbeitsblatt, Self Control - Deutsch, Beileid Zum Tod Der Mutter Einer Freundin, Ich Gehe Nicht Zur Mammographie,